PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005377m
Common NameEUTSA_v10005377mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 292aa    MW: 34536.7 Da    PI: 6.0592
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005377mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like703.7e-22201250151
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      k r++W +eLH++F+eav+ L G+++A+Pk+ile m+v+g+t+e+v+SHLQ
  Thhalv10005377m 201 KRRVVWDEELHSKFIEAVRYL-GKDHAVPKRILERMNVDGITRENVASHLQ 250
                      689******************.9**************************** PP

2Response_reg37.11.7e-134814313108
                      HHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--H CS
     Response_reg  13 llrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdp 104
                       l+q l++ +y ev+ + + e a+ ll++++  +D+ ++  +  + d +++++ei +e  +lpii+++  ++ e +++ ++ Ga d+l Kp+  
  Thhalv10005377m  48 TLEQHLQEFQY-EVTKCNEEERAMYLLRNHRnrFDIAIIEAQNAHGDRFRFISEIGSEM-DLPIIIISNDDSVESVINWMNNGACDYLIKPIRY 139
                      4789999****.***************999999**********************7755.8*******************************99 PP

                      HHHH CS
     Response_reg 105 eelv 108
                      e+l+
  Thhalv10005377m 140 EDLR 143
                      9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.83E-1834150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.1E-1835182No hitNo description
PROSITE profilePS5011018.13135150IPR001789Signal transduction response regulator, receiver domain
SMARTSM004480.002836146IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.79E-839143No hitNo description
PfamPF000729.8E-939144IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129411.396198257IPR017930Myb domain
SuperFamilySSF466891.97E-15198255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-20199250IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-24201254IPR006447Myb domain, plants
PfamPF002493.8E-6203250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTEKWEPEIH DGVDPSRYHP NSSDMFPGMY KFPEGLRVLL FDEDPTLTLE QHLQEFQYEV  60
TKCNEEERAM YLLRNHRNRF DIAIIEAQNA HGDRFRFISE IGSEMDLPII IISNDDSVES  120
VINWMNNGAC DYLIKPIRYE DLRLIFKYQT RGEEDTSMDE CGSGRRGRGE SRNREFIFCE  180
RSHRQENKEG HDHDRDPTTK KRRVVWDEEL HSKFIEAVRY LGKDHAVPKR ILERMNVDGI  240
TRENVASHLQ VTFSYYITRA VNKHDSYTTF LDQNSKSILI TNHKIIYDRR L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-16200250454ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395079.10.0hypothetical protein EUTSA_v10005377mg
SwissprotQ9FJ162e-86APRR4_ARATH; Putative two-component response regulator-like APRR4
TrEMBLV4K4980.0V4K498_EUTSA; Uncharacterized protein
STRINGBra037427.1-P7e-87(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132221624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49240.13e-85pseudo-response regulator 4